PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015874011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 745aa    MW: 84161.2 Da    PI: 4.9417
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015874011.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS381.21.2e-1163737421373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lL+ cA+avss d + a++lL+++++++sp+gd  qRla+yf ++L+arla++++e+y++l++++t+    ++ l+a+++++ ++P+ k++ 
  XP_015874011.1 373 LRTLLILCAQAVSSYDVRTATELLKQIRQHSSPYGDGSQRLAHYFSNGLEARLAGTGTEIYASLASKRTA----ADMLKAYQVYVSACPFKKIAI 463
                     5789*********************************************************999999886....9******************** PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                       aN++I +a+e++e +HiiDf+i +G+QWpaL+q L+ R++gpp+lRiTg++ p++g   +++++etg+rLa+++e+++vpfe+n+ +a+++e+
  XP_015874011.1 464 AFANNMISKAAEKAENLHIIDFGILYGFQWPALIQCLSRRSGGPPKLRITGIEFPQHGfrPAQQVQETGRRLARYCERFNVPFEYNA-IAQQWET 557
                     *********************************************************9*****************************.7****** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     +++e+L++ ++E++aVn+ ++ ++llde+v ++s+rd+vL+l+++++P+++v++ ++ ++n++ F++rf eal  +s+ fd+ +a+l re+  r 
  XP_015874011.1 558 IQIEDLKIVRDEVVAVNCLFRFKNLLDETVVVDSPRDAVLNLIRTIRPDIFVHAISNGSYNAPFFVTRFREALFQFSSWFDMSDATLDRENPMRL 652
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                     ++E+e+lgrei n+vaceg+er+er et+++W+ r ++a F+++pl+ + +k+ k+ ++  ++  ++v+e+ +++++gWk+r +++ S+W
  XP_015874011.1 653 MYEKEFLGREIINIVACEGSERVERPETYKQWQVRTKRARFRQLPLDFELMKKLKCRVEGGYDSNFMVDEDGNWMLQGWKGRVMFASSCW 742
                     **************************************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.168347723IPR005202Transcription factor GRAS
PfamPF035144.3E-114373742IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 745 aa     Download sequence    Send to blast
MDQSFTRLLN FDLHPNSDLN PNIVNLTQLN NPSPNLSMSS ESDSPSDDGD FSDSVLKYIS  60
QMLMEENMEK ELSMFHDPLA LQAAEKSLYE VLGEKYPPSP NQHPLYYTSD RNIESPDDHF  120
WPSPGDSTTR TSNSASTSSS NTGNSVQSSR TYVDPSEYEP SILQTPLPVD FVFQSTSVSS  180
SQTTSNLQDN ITDNGNGNGL VGSSLNELLE PNSFSESDLM MQFKRGVEEG NKFLPKSPQL  240
VIDLDSYELP PESNKNVSDS LVKVEKEERD HSPTELRGRK NHEREETDLE DGRSNKQSAI  300
YMEDGQETEL SEMFDKVLLC NVGKGRGGLI CEDGGGFGNG GKKFSQQDEK SNKSSSGKSR  360
SKMQENKKEV VDLRTLLILC AQAVSSYDVR TATELLKQIR QHSSPYGDGS QRLAHYFSNG  420
LEARLAGTGT EIYASLASKR TAADMLKAYQ VYVSACPFKK IAIAFANNMI SKAAEKAENL  480
HIIDFGILYG FQWPALIQCL SRRSGGPPKL RITGIEFPQH GFRPAQQVQE TGRRLARYCE  540
RFNVPFEYNA IAQQWETIQI EDLKIVRDEV VAVNCLFRFK NLLDETVVVD SPRDAVLNLI  600
RTIRPDIFVH AISNGSYNAP FFVTRFREAL FQFSSWFDMS DATLDRENPM RLMYEKEFLG  660
REIINIVACE GSERVERPET YKQWQVRTKR ARFRQLPLDF ELMKKLKCRV EGGYDSNFMV  720
DEDGNWMLQG WKGRVMFASS CWIPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-443777428374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015874011.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLW9RUF90.0W9RUF9_9R
STRINGPOPTR_0009s03790.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14